CDS

Accession Number TCMCG017C24906
gbkey CDS
Protein Id OMO73009.1
Location complement(join(167904..167974,168082..168178,169907..170018,170175..170179))
Organism Corchorus olitorius
locus_tag COLO4_27351

Protein

Length 94aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA215141, BioSample:SAMN03160584
db_source AWUE01019531.1
Definition hypothetical protein COLO4_27351 [Corchorus olitorius]
Locus_tag COLO4_27351

EGGNOG-MAPPER Annotation

COG_category I
Description Catalyzes the third of the four reactions of the long- chain fatty acids elongation cycle. This endoplasmic reticulum- bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates to the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators
KEGG_TC -
KEGG_Module M00415        [VIEW IN KEGG]
KEGG_Reaction R07760        [VIEW IN KEGG]
R10827        [VIEW IN KEGG]
KEGG_rclass RC00770        [VIEW IN KEGG]
RC01095        [VIEW IN KEGG]
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko00002        [VIEW IN KEGG]
ko01000        [VIEW IN KEGG]
ko01004        [VIEW IN KEGG]
KEGG_ko ko:K10703        [VIEW IN KEGG]
EC 4.2.1.134        [VIEW IN KEGG]        [VIEW IN INGREDIENT]
KEGG_Pathway ko00062        [VIEW IN KEGG]
ko01040        [VIEW IN KEGG]
ko01110        [VIEW IN KEGG]
ko01212        [VIEW IN KEGG]
map00062        [VIEW IN KEGG]
map01040        [VIEW IN KEGG]
map01110        [VIEW IN KEGG]
map01212        [VIEW IN KEGG]
GOs GO:0003674        [VIEW IN EMBL-EBI]
GO:0003824        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005783        [VIEW IN EMBL-EBI]
GO:0005789        [VIEW IN EMBL-EBI]
GO:0006082        [VIEW IN EMBL-EBI]
GO:0006629        [VIEW IN EMBL-EBI]
GO:0006631        [VIEW IN EMBL-EBI]
GO:0006633        [VIEW IN EMBL-EBI]
GO:0006643        [VIEW IN EMBL-EBI]
GO:0006665        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0008610        [VIEW IN EMBL-EBI]
GO:0009058        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0012505        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0016021        [VIEW IN EMBL-EBI]
GO:0016053        [VIEW IN EMBL-EBI]
GO:0016829        [VIEW IN EMBL-EBI]
GO:0016835        [VIEW IN EMBL-EBI]
GO:0016836        [VIEW IN EMBL-EBI]
GO:0018812        [VIEW IN EMBL-EBI]
GO:0019752        [VIEW IN EMBL-EBI]
GO:0030148        [VIEW IN EMBL-EBI]
GO:0030176        [VIEW IN EMBL-EBI]
GO:0030497        [VIEW IN EMBL-EBI]
GO:0031224        [VIEW IN EMBL-EBI]
GO:0031227        [VIEW IN EMBL-EBI]
GO:0031984        [VIEW IN EMBL-EBI]
GO:0032787        [VIEW IN EMBL-EBI]
GO:0042175        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043436        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044249        [VIEW IN EMBL-EBI]
GO:0044255        [VIEW IN EMBL-EBI]
GO:0044281        [VIEW IN EMBL-EBI]
GO:0044283        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044425        [VIEW IN EMBL-EBI]
GO:0044432        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0046394        [VIEW IN EMBL-EBI]
GO:0046467        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0072330        [VIEW IN EMBL-EBI]
GO:0098827        [VIEW IN EMBL-EBI]
GO:1901564        [VIEW IN EMBL-EBI]
GO:1901566        [VIEW IN EMBL-EBI]
GO:1901576        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGCGTTTCAAGTTCTGTTTTTGACGCTGAAGACTTTGAAGGAATCAGGTCATGAACACGTCTACAATGCCGTTGAGAAGCCTCTTCTTCTCGCTCAATCCGCCGCCGTTTTGGAGGCTTCTGAGAAATACTGCATGAGAATGCCAAACAAGTTGAACTTCTCTTTTGATTACTACTATGCTGCAATTGCTATTCTTGGATTCTATGTCCCAGGTAGTCCTCACCTATACAGTTACATGCTCAGTCAGAGGAAGAGAGCTCTTTCCAAATCGAAAAAAGAGTAG
Protein:  
MAFQVLFLTLKTLKESGHEHVYNAVEKPLLLAQSAAVLEASEKYCMRMPNKLNFSFDYYYAAIAILGFYVPGSPHLYSYMLSQRKRALSKSKKE